Your position: Home / Cardiovascular Peptides / 172627

Human Calcitonin Related Intermedin KS-V Peptide Catalog Number KS091008 CAS 1188922-20-4

SKU. 172627

$ 749

Stock:: 10 in Stock

Quantity:: - +
piece(s)

Shipping:: $ 44.65

Can't deliver

To Be Negotiated

to United States Change

Estimated delivery time : 0-27 working days.

Total Price:: $ 749 $ 749 save $ 0.00

Shipping calculated at checkout.

Buy Now

Add to Cart

Shipping & Returns
Get a Quote

Description
Specification
Q & A
Customer Reviews
Shipping Policy
Wholesale Inquiry

Intermedin (human),Catalog Number: KS091008,CAS NO.: 1188922-20-4

Intermedins are a part of the calcitonin/gene-related peptide (CGRP) family. In vitro experimentation has demonstrated that the synthetic 47 amino acid intermedin peptides act via the calcitonin receptor-like receptor/receptor activity-modifying protein (CRLR/RAMP) complexes by increasing the levels of intracellular cAMP. Unlike calcitonin gene-related peptide (CGRP) and adrenomedullin (ADM), intermedin does not exhibit selectivity for any of the three RAMPs when co-expressed with CRLR. Studies on normal and spontaneously hypertensive rats have shown that intermedin treatment leads to a reduction in blood pressure that can be prevented by the CGRP receptor antagonist CGRP (8-37). In addition to its hypotensive effects, synthetic intermedin has also been observed to inhibit gastric emptying and food intake in mice. Thus, intermedin serves as an additional regulator of gastrointestinal and cardiovascular functions, and may also be involved in other bioactivities mediated by the CRLR/RAMP receptor complexes.

Catalog Number KS091008
Product Name Intermedin (human)
Sequence TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 (trifluoroacetate salt) (Disulfide bond Cys10 an
CAS NO. 1188922-20-4
price/1mg $749
Purity ≥95% (HPLC)
Molecular Formula C₂₁₉H₃₄₉N₆₉O₆₆S₃
Molecular Weight 5100.8
Form Lyophilized
Storage Store at -20°C or -80°C

Ask a Question

No data

Average rating:

Share your thoughts with other customers

Write a review

Our products are shipped from China, the dispatching date will be commenced in few business days after the finishing of QC from the related department.

Detailed tracking information will be offered to your mailbox in an automatic manner as long as we officially dispatched your package from our sorting center.

Customer is advised to check more tracking information from “My Account” after the account sign in.

It occasionally comes to the situation for no displaying of tracking information after the receiving of shipment notification. Please be advised to wait for 1-2 business days until the updating of pertinent tracking information in your account center.

Expedited shipment

The changing of the shipping methods may have occurred when we are noticed from customer for the needing of rush order or lower rate of shipment delay. The related request is acceptable whenever in prior of the order is dispatched and heading to the designated shipping address.

Note: (PO) boxes or FPO/APO military addresses can only be shipped out by standard shipping method).

The shipping fare for the expedited shipment method may higher than the standard one you chose for, then please be aware that you may ask to pay for the balance for the pertinent shipment substitution. You are welcome to contact our customer service via “contact us” for further inquiry and requisition

Shipping cost all about

It is deeply appreciated to take your kind pardon for any misunderstanding about the shipping price due to the package is shipped from China.

The contract we have stipulated with FedEx, DHL, UPS and EMS is already set and therefore all merchandise is sent via Air rather than Ground. While this may not be the most cost effective for all customers, in terms of delivery time, ease of shipment and reliability we have determined that this is the most effective overall.

The shipping cost for all merchandises are displayed by adding items to your shipping bag, you can estimate shipping time and cost and acquire more shipping cost information from our site.

International Shipping

International shipping costs are calculated in U.S. currency based on estimated shipment weight and destination. Shipping costs for orders placed on the website are fairly accurate, but there are times when those estimates are incorrect. If we need to adjust shipping charges for your order we will contact you to authorize those additional shipping charges.

*Your Target Price:

Please enter your target price

*Order Quantity:

Please provide a quantity

*Country:

United States

*Your Name:

Please provide your name

*Email Address:

Please enter your email adress

Enter a valid email address

Telephone Number:

Please enter the phone number

*Detailed Inquiry Information:

Please enter the inquiry information

Submit

Reach Us
USA: 6323 Nancy Ridge Dr, San Diego, CA 92121, USA
86-0551-65120828
- Contact Person: Mrs.tong
- Business Phone: 86-1888-377-6111
- Email: tonghuarong@difficultpeptide.com