Shipping calculated at checkout.
ShK Toxin,CAS#:172450-46-3,Catalog Number: K1010-V,Sequence:RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.
Our products are shipped from China, the dispatching date will be commenced in few business days after the finishing of QC from the related department.
Detailed tracking information will be offered to your mailbox in an automatic manner as long as we officially dispatched your package from our sorting center.
Customer is advised to check more tracking information from “My Account” after the account sign in.
It occasionally comes to the situation for no displaying of tracking information after the receiving of shipment notification. Please be advised to wait for 1-2 business days until the updating of pertinent tracking information in your account center.
Expedited shipment
The changing of the shipping methods may have occurred when we are noticed from customer for the needing of rush order or lower rate of shipment delay. The related request is acceptable whenever in prior of the order is dispatched and heading to the designated shipping address.
Note: (PO) boxes or FPO/APO military addresses can only be shipped out by standard shipping method).
The shipping fare for the expedited shipment method may higher than the standard one you chose for, then please be aware that you may ask to pay for the balance for the pertinent shipment substitution. You are welcome to contact our customer service via “contact us” for further inquiry and requisition
Shipping cost all about
It is deeply appreciated to take your kind pardon for any misunderstanding about the shipping price due to the package is shipped from China.
The contract we have stipulated with FedEx, DHL, UPS and EMS is already set and therefore all merchandise is sent via Air rather than Ground. While this may not be the most cost effective for all customers, in terms of delivery time, ease of shipment and reliability we have determined that this is the most effective overall.
The shipping cost for all merchandises are displayed by adding items to your shipping bag, you can estimate shipping time and cost and acquire more shipping cost information from our site.
International Shipping
International shipping costs are calculated in U.S. currency based on estimated shipment weight and destination. Shipping costs for orders placed on the website are fairly accurate, but there are times when those estimates are incorrect. If we need to adjust shipping charges for your order we will contact you to authorize those additional shipping charges.
Please enter your target price
Please provide a quantity
United States
Please provide your name
Please enter your email adress
Enter a valid email address
Please enter the phone number
Please enter the inquiry information
PLTX-II Peptide Toxins Potent Neurotoxin Catalog Number C1100-V
Lyophilized Protoxin II CAS 165168-50-3 Catalog Number N1030-V
Mambalgin-1 Peptide Toxins Catalog Number O1010-V CAS 1609937-15-6
Dendrotoxin-I Blocker CAS 107950-33-4 Catalog Number K1030-V
Muscarinic Toxin 3 M3 Muscarinic Receptor Antagonist Catalog Number O1100-V
μ-conotoxin GIIIA Peptide Toxins CAS 129129-65-3 Catalog Number N1010-V
SNX482,CAS#:203460-30-4,Lyophilized,Catalog Number: C1080-V
ASIC1a Channels Psalmotoxin 1 Catalog Number O1120-V
Bee Venom Tertiapin-Q Blocker Catalog Number K1120-V
3FTx Mambalgin-2 Snake Venom Peptide Catalog Number O1020-V
Mastoparan Peptide Toxins Catalog Number KS201001 CAS 72093-21-1
KS-V huwentoxin IV CAS 526224-73-7 Catalog Number N1020-V
Charybdotoxin Peptide Toxins Inhibitor CAS 95751-30-7 Catalog Number K1080-V
Leiurotoxin I Scyllatoxin Neurotoxin Catalog Number K1100-V
Margatoxin Peptide CAS 145808-47-5 Catalog Number K1020-V
Apamin Bee Venom Peptide Toxins Catalog Number K1090-V
LINK-PP LPJ1075-1BHNL 100% Cross RTA-110AHQ1A UDE
United States
Carrier
CostDelivery TimeTracking
Fedex IP
$ 44.65 0-27 daysAvailable
ShK Toxin Peptide Toxins CAS 172450-46-3 Catalog Number K1010-V