Your position: Home / Cardiovascular Peptides / 172620

Adrenomedullin (1-52) (Human) CGRP Cardiovascular Peptides Catalog KS091005 CAS 148498-78-6

SKU. 172620

$ 765

Stock:: 10 in Stock

Quantity:: - +
milligram(s)

Shipping:: $ 44.65

Can't deliver

To Be Negotiated

to United States Change

Estimated delivery time : 0-27 working days.

Total Price:: $ 765 $ 765 save $ 0.00

Shipping calculated at checkout.

Buy Now

Add to Cart

Shipping & Returns
Get a Quote

Description
Specification
Q & A
Customer Reviews
Shipping Policy
Wholesale Inquiry

Adrenomedullin (1-52) (human),Catalog Number: KS091005,CAS NO.: 148498-78-6

Adrenomedullin (AM or ADM) is a peptide comprising 52 amino acids that was first identified in pheochromocytoma, a tumor of the adrenal medulla. Its nomenclature reflects its origin. Emerging evidence suggests that Adrenomedullin exerts various biological actions, such as vasodilation, cell proliferation, modulation of hormone secretion, natriuresis, and antimicrobial activity.

Catalog Number KS091005
Product Name Adrenomedullin (1-52) (human)
Sequence YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate salt) (Cys16 and 21 bridg
CAS NO. 148498-78-6
price/1mg $765
Purity ≥95% (HPLC)
Molecular Formula C₂₆₄H₄₀₆N₈₀O₇₇S₃
Molecular Weight 6028.9
Form Lyophilized
Storage Store at -20°C or -80°C

Ask a Question

No data

Average rating:

Share your thoughts with other customers

Write a review

Our products are shipped from China, the dispatching date will be commenced in few business days after the finishing of QC from the related department.

Detailed tracking information will be offered to your mailbox in an automatic manner as long as we officially dispatched your package from our sorting center.

Customer is advised to check more tracking information from “My Account” after the account sign in.

It occasionally comes to the situation for no displaying of tracking information after the receiving of shipment notification. Please be advised to wait for 1-2 business days until the updating of pertinent tracking information in your account center.

Expedited shipment

The changing of the shipping methods may have occurred when we are noticed from customer for the needing of rush order or lower rate of shipment delay. The related request is acceptable whenever in prior of the order is dispatched and heading to the designated shipping address.

Note: (PO) boxes or FPO/APO military addresses can only be shipped out by standard shipping method).

The shipping fare for the expedited shipment method may higher than the standard one you chose for, then please be aware that you may ask to pay for the balance for the pertinent shipment substitution. You are welcome to contact our customer service via “contact us” for further inquiry and requisition

Shipping cost all about

It is deeply appreciated to take your kind pardon for any misunderstanding about the shipping price due to the package is shipped from China.

The contract we have stipulated with FedEx, DHL, UPS and EMS is already set and therefore all merchandise is sent via Air rather than Ground. While this may not be the most cost effective for all customers, in terms of delivery time, ease of shipment and reliability we have determined that this is the most effective overall.

The shipping cost for all merchandises are displayed by adding items to your shipping bag, you can estimate shipping time and cost and acquire more shipping cost information from our site.

International Shipping

International shipping costs are calculated in U.S. currency based on estimated shipment weight and destination. Shipping costs for orders placed on the website are fairly accurate, but there are times when those estimates are incorrect. If we need to adjust shipping charges for your order we will contact you to authorize those additional shipping charges.

*Your Target Price:

Please enter your target price

*Order Quantity:

Please provide a quantity

*Country:

United States

*Your Name:

Please provide your name

*Email Address:

Please enter your email adress

Enter a valid email address

Telephone Number:

Please enter the phone number

*Detailed Inquiry Information:

Please enter the inquiry information

Submit

Reach Us
USA: 6323 Nancy Ridge Dr, San Diego, CA 92121, USA
86-0551-65120828
- Contact Person: Mrs.tong
- Business Phone: 86-1888-377-6111
- Email: tonghuarong@difficultpeptide.com